Chicken Airfryer

Chicken Airfryer
Chicken Airfryer

Chicken Airfryer

Chicken air fryer recipes to try at home


Reviews
0.00%
0.00%
0.00%
0.00%
0.00%
★★
★★★
★★★★
★★★★★
0 rates
0 rates
0 rates
0 rates
0 rates
com.chiickeninnrecipes.airfryerchickenrecipes
Installs: 100+ (105 at 2024-03-04 13:58:39)
Version: 1.0
Category: Food & Drink
Pegi : Everyone
Publish Date : Mar 13, 2023
Update Date : 2023-03-14
Android Version : 5.0
In-App-Purchase : $89.99 - $144.99 per item
Available on
Get it on Google Play
Publisher
Other Apps from Happy pets
Air Fryer Side Dish
Air Fryer Side Dish
★ 0.0 FREE
Side dish Air Fryer Recipes to try at home
Gravy, Jus, and Pan Sauce
Gravy, Jus, and Pan Sauce
★ 0.0 FREE
Gravy, Jus, and Pan Sauce recipes for every cook
Cats and Dog Bulk and Budget m
Cats and Dog Bulk and Budget m
★ 0.0 FREE
Cats and Dog Bulk and Budget meals to try at home.
Similar Apps
Mayonnaise Sauce guide
Mayonnaise Sauce guide
Mayonnaise Sauce guide
★ 0.0 FREE 100+
Happy pets
Mayonnaise Sauce recipe guide for you
Cookstro
Cookstro
Cookstro
★ 0.0 FREE 100+
Cookstro Inc.
The meals are homemade.
Air Fryer Side Dish
Air Fryer Side Dish
Air Fryer Side Dish
★ 0.0 FREE 10+
Happy pets
Side dish Air Fryer Recipes to try at home
Mealology
Mealology
Mealology
★ 3.8 FREE 1,000+
Mealology LLC
Making it fun to meal plan
HomeID (Kitchen+)
HomeID (Kitchen+)
HomeID (Kitchen+)
★ 3.7 FREE 5,000,000+
Versuni Netherlands B.V.
Make home even better with great coffee, delicious Airfryer recipes and more.
TheChefPrepMeals
TheChefPrepMeals
TheChefPrepMeals
★ 0.0 FREE 1,000+
Combustion
Browse meals, view nutritional info, and quickly order right to your door!
Air Fryer Recipes
Air Fryer Recipes
Air Fryer Recipes
★ 4.1 FREE 100,000+
Rstream Labs
Oil-free air fryer recipes app for chicken, french fries with instant cook times
Dinnerly
Dinnerly
Dinnerly
★ 4.5 FREE 100,000+
Marley Spoon
America`s most affordable meal kit!
Sushi recipes: cookbook with c
Sushi recipes: cookbook with c
Sushi recipes: cookbook with c
★ 0.0 FREE 1,000+
iSottcom
It can be so easy to make sushi at home! Recipes, cooking instructions and more.
GoalQuest: daily goal coaching
GoalQuest: daily goal coaching
GoalQuest: daily goal coaching
★ 4.5 FREE 1,000+
GoalQuest App
Achieve your goals, one quest at a time with Goal Quest - Daily Goal Coaching!
Screenshots
 - Android App Screenshot  - Android App Screenshot  - Android App Screenshot
DESCRIPTION
Welcome to my air fryer chicken cookery. I wanted to create a recipe app with my favorite chicken recipes that I have made since I bought my air fryer and these are them. They are perfect for children and adults alike thanks to the mix of recipes. They are simple to make and taste so much better than the low-quality ones that you get at fast food restaurants.
The recipes are well equipped with nutritional servings, ingredients and directions that can easily be followed. Enjoy the app.
RECENT CHANGES
Chicken air fryer recipes to try at home
DATA SAFETY AND SECURITY
Free apps in the same category
Vegan Food Recipes Diet Plan
Vegan Food Recipes Diet Plan
Vegan Food Recipes Diet Plan
★ 4.3 FREE 50,000+
Edutainment Ventures- Making Games People Play
Enjoy a Healthy Vegan Life with Health Tips, Community & Fitness tracker Offline
Grubhub: Food Delivery
Grubhub: Food Delivery
Grubhub: Food Delivery
★ 4.5 FREE 10,000,000+
Grubhub
Food delivery from your favorite places. Order food, alcohol and more nearby
Easy Recipes
Easy Recipes
Easy Recipes
★ 4.6 FREE 100,000+
Endless
Quick and easy healthy recipes collection
Bon APPetit - Recipes for ever
Bon APPetit - Recipes for ever
Bon APPetit - Recipes for ever
★ 4.4 FREE 50,000+
Apps From the Locker
Discover everyday tasty and free recipes that teach to love food and life.
Dinner Recipes
Dinner Recipes
Dinner Recipes
★ 4.4 FREE 100,000+
DIL Studio
Recipe book with easy dinner recipes. All recipes with photos and reviews.
Salad Recipes : Healthy Diet
Salad Recipes : Healthy Diet
Salad Recipes : Healthy Diet
★ 4.7 FREE 1,000,000+
Edutainment Ventures- Making Games People Play
Enjoy nutritious salads offline with health tips, communities & fitness tracker.
Paid apps in the same category
Love, Manuela The Baking APP
Love, Manuela The Baking APP
Love, Manuela The Baking APP
★ 4.2 12.99$ 5,000+
Manuela Kjeilen
Home baked, made easy! Passionate baking with Mauela Kjeilen @passionforbaking
Oh She Glows - Healthy Recipes
Oh She Glows - Healthy Recipes
Oh She Glows - Healthy Recipes
★ 4.7 2.99$ 50,000+
Oh She Glows
Enjoy over 175 mouth-watering plant-based recipes at your fingertips.
Jason Vale’s Super Blend Me
Jason Vale’s Super Blend Me
Jason Vale’s Super Blend Me
★ 3.9 7.99$ 5,000+
Juice Master
Jason Vale’s first ever protein-based, blending plan.
My Cocktail Bar Pro
My Cocktail Bar Pro
My Cocktail Bar Pro
★ 4.6 1.99$ 10,000+
Roman Shu
The fast and practical app to help you make the best cocktails at home!
101 Juice Recipes
101 Juice Recipes
101 Juice Recipes
★ 4.7 9.99$ 10,000+
Joe Cross
New to juicing? Looking for new recipes? Our app features 101 juice recipes.
Popular Free Games
Subway Surfers
Subway Surfers
Subway Surfers
★ 4.6 FREE 1,000,000,000+
SYBO Games
Arcade Games
Help Jake, Tricky & Fresh escape from the grumpy Inspector and his dog!
Candy Crush Saga
Candy Crush Saga
Candy Crush Saga
★ 4.6 FREE 1,000,000,000+
King
Casual Games
Spread jam, pop jelly, blast candies & master sugar sweet match-3 puzzle games.
Free Fire
Free Fire
Free Fire
★ 4.2 FREE 1,000,000,000+
Garena International I
Action Games
10-minute Survival Shooter!
My Talking Tom
My Talking Tom
My Talking Tom
★ 4.2 FREE 1,000,000,000+
Outfit7 Limited
Casual Games
It’s Talking Tom, the virtual pet cat who loves to chat.
8 Ball Pool
8 Ball Pool
8 Ball Pool
★ 4.6 FREE 1,000,000,000+
Miniclip.com
Sports Games
Play online multiplayer or PvP Pool games and compete with your friends!
Hill Climb Racing
Hill Climb Racing
Hill Climb Racing
★ 4.4 FREE 1,000,000,000+
Fingersoft
Racing Games
Race uphill to win in this offline physics based driving game!
Popular Free Applications
Google Drive
Google Drive
Google Drive
★ 4.3 FREE 10,000,000,000+
Google LLC
Productivity
Store, access, and share securely with Google Drive, part of Google Workspace.
Google Photos
Google Photos
Google Photos
★ 4.4 FREE 10,000,000,000+
Google LLC
Photography
The home for your memories. Relive, share, and organize your photos.
Facebook
Facebook
Facebook
★ 4.5 FREE 5,000,000,000+
Meta Platforms, Inc.
Social
Explore the things you love
WhatsApp Messenger
WhatsApp Messenger
WhatsApp Messenger
★ 4.3 FREE 5,000,000,000+
WhatsApp LLC
Communication
Simple. Reliable. Private.
Gboard - the Google Keyboard
Gboard - the Google Keyboard
Gboard - the Google Keyboard
★ 4.5 FREE 5,000,000,000+
Google LLC
Tools
Fast and smart typing with Emojis, GIFs, and more
Google Meet
Google Meet
Google Meet
★ 4.5 FREE 5,000,000,000+
Google LLC
Communication
High quality video calling for Android & iOS phones, tablets, Google Nest & web.