Chicken Airfryer

Chicken Airfryer
Chicken Airfryer

Chicken Airfryer

Chicken air fryer recipes to try at home


Reviews
0.00%
0.00%
0.00%
0.00%
0.00%
★★
★★★
★★★★
★★★★★
0 rates
0 rates
0 rates
0 rates
0 rates
com.chiickeninnrecipes.airfryerchickenrecipes
Installs: 100+ (105 at 2024-03-04 13:58:39)
Version: 1.0
Category: Food & Drink
Pegi : Everyone
Publish Date : Mar 13, 2023
Update Date : 2023-03-14
Android Version : 5.0
In-App-Purchase : $89.99 - $144.99 per item
Available on
Get it on Google Play
Publisher
Other Apps from Happy pets
Cats and Dog Bulk and Budget m
Cats and Dog Bulk and Budget m
★ 0.0 FREE
Cats and Dog Bulk and Budget meals to try at home.
Air Fryer Side Dish
Air Fryer Side Dish
★ 0.0 FREE
Side dish Air Fryer Recipes to try at home
Mayonnaise Sauce guide
Mayonnaise Sauce guide
★ 0.0 FREE
Mayonnaise Sauce recipe guide for you
Similar Apps
Fast Food Recipes Cookbook
Fast Food Recipes Cookbook
Fast Food Recipes Cookbook
★ 4.3 FREE 100,000+
Mobi App Studio
Enjoy Healthy nutritious homemade and with fitness Fast Food Recipes for you.
Anova Culinary
Anova Culinary
Anova Culinary
★ 4.5 FREE 1,000,000+
Anova Culinary
Sous vide recipes and guides
Mayonnaise Sauce guide
Mayonnaise Sauce guide
Mayonnaise Sauce guide
★ 0.0 FREE 100+
Happy pets
Mayonnaise Sauce recipe guide for you
Cookstro
Cookstro
Cookstro
★ 0.0 FREE 100+
Cookstro Inc.
The meals are homemade.
Air Fryer Side Dish
Air Fryer Side Dish
Air Fryer Side Dish
★ 0.0 FREE 10+
Happy pets
Side dish Air Fryer Recipes to try at home
Mealology
Mealology
Mealology
★ 3.8 FREE 1,000+
Mealology LLC
Making it fun to meal plan
TheChefPrepMeals
TheChefPrepMeals
TheChefPrepMeals
★ 0.0 FREE 500+
Combustion
Browse meals, view nutritional info, and quickly order right to your door!
Dinnerly
Dinnerly
Dinnerly
★ 4.6 FREE 100,000+
Marley Spoon
America`s most affordable meal kit!
Air Fryer Recipes
Air Fryer Recipes
Air Fryer Recipes
★ 4.1 FREE 100,000+
Rstream Labs
Oil-free air fryer recipes app for chicken, french fries with instant cook times
HomeID (Kitchen+)
HomeID (Kitchen+)
HomeID (Kitchen+)
★ 3.8 FREE 1,000,000+
Versuni Netherlands B.V.
Make home even better with great coffee, delicious Airfryer recipes and more.
Screenshots
 - Android App Screenshot  - Android App Screenshot  - Android App Screenshot
DESCRIPTION
Welcome to my air fryer chicken cookery. I wanted to create a recipe app with my favorite chicken recipes that I have made since I bought my air fryer and these are them. They are perfect for children and adults alike thanks to the mix of recipes. They are simple to make and taste so much better than the low-quality ones that you get at fast food restaurants.
The recipes are well equipped with nutritional servings, ingredients and directions that can easily be followed. Enjoy the app.
RECENT CHANGES
Chicken air fryer recipes to try at home
DATA SAFETY AND SECURITY
Free apps in the same category
KFC Suriname
KFC Suriname
KFC Suriname
★ 3.1 FREE 1,000,000+
GlobalFood - an Oracle company
Enjoy food from the restaurant you love.
Pizza Maker - Homemade Pizza
Pizza Maker - Homemade Pizza
Pizza Maker - Homemade Pizza
★ 3.8 FREE 100,000+
Riafy Technologies
Cook tasty recipes like neapolitan pizza, non-vegetarian, italian etc.
Jumia Food: Food Delivery
Jumia Food: Food Delivery
Jumia Food: Food Delivery
★ 3.5 FREE 10,000,000+
JUMIA
Everything You Need, Delivered Now - Food, Groceries, Gifts, Pharmacy and more
Drink and Cocktail Recipes App
Drink and Cocktail Recipes App
Drink and Cocktail Recipes App
★ 3.9 FREE 100,000+
Riafy Technologies
Learn to mix delicious cocktails & non-alcoholic drinks. Detailed recipe guides
Hungerstation
Hungerstation
Hungerstation
★ 4.1 FREE 10,000,000+
HungerStation Care
Get everything delivered the FASTEST!
Popeyes Suriname
Popeyes Suriname
Popeyes Suriname
★ 3.8 FREE 100,000+
GlobalFood - an Oracle company
Enjoy food from the restaurant you love.
Paid apps in the same category
My Cocktail Bar Pro
My Cocktail Bar Pro
My Cocktail Bar Pro
★ 4.5 1.99$ 10,000+
Roman Shu
The fast and practical app to help you make the best cocktails at home!
101 Juice Recipes
101 Juice Recipes
101 Juice Recipes
★ 4.7 9.99$ 10,000+
Joe Cross
New to juicing? Looking for new recipes? Our app features 101 juice recipes.
Jason Vale’s Super Blend Me
Jason Vale’s Super Blend Me
Jason Vale’s Super Blend Me
★ 3.9 7.99$ 5,000+
Juice Master
Jason Vale’s first ever protein-based, blending plan.
BLW Slow Cook Recipes
BLW Slow Cook Recipes
BLW Slow Cook Recipes
★ 4.9 4.99$ 5,000+
Starsky Creative Ltd. (Natalie Peall)
Enjoy over 130 quick and easy slow cook recipes perfect for baby-led weaning
Love, Manuela
Love, Manuela
Love, Manuela
★ 4.2 12.99$ 5,000+
Manuela Kjeilen
Home baked, made easy
Oh She Glows - Healthy Recipes
Oh She Glows - Healthy Recipes
Oh She Glows - Healthy Recipes
★ 4.7 2.99$ 50,000+
Oh She Glows
Enjoy over 175 mouth-watering plant-based recipes at your fingertips.
Popular Free Games
Subway Surfers
Subway Surfers
Subway Surfers
★ 4.6 FREE 1,000,000,000+
SYBO Games
Arcade Games
Help Jake, Tricky & Fresh escape from the grumpy Inspector and his dog!
Candy Crush Saga
Candy Crush Saga
Candy Crush Saga
★ 4.6 FREE 1,000,000,000+
King
Casual Games
Match 3 candies to blast sugar! Spread jam & master the sweetest of puzzle games
Free Fire
Free Fire
Free Fire
★ 4.2 FREE 1,000,000,000+
Garena International I
Action Games
10-minute Survival Shooter!
My Talking Tom
My Talking Tom
My Talking Tom
★ 4.4 FREE 1,000,000,000+
Outfit7 Limited
Casual Games
It’s Talking Tom, the virtual pet cat who loves to chat.
8 Ball Pool
8 Ball Pool
8 Ball Pool
★ 4.5 FREE 1,000,000,000+
Miniclip.com
Sports Games
Play online multiplayer or PvP Pool games and compete with your friends!
Hill Climb Racing
Hill Climb Racing
Hill Climb Racing
★ 4.5 FREE 1,000,000,000+
Fingersoft
Racing Games
Race uphill to win in this offline physics based driving game!
Popular Free Applications
Google Drive
Google Drive
Google Drive
★ 4.3 FREE 10,000,000,000+
Google LLC
Productivity
Store, access, and share securely with Google Drive, part of Google Workspace.
Google Photos
Google Photos
Google Photos
★ 4.5 FREE 5,000,000,000+
Google LLC
Photography
The home for your memories. Relive, share, and organize your photos.
Gboard - the Google Keyboard
Gboard - the Google Keyboard
Gboard - the Google Keyboard
★ 4.5 FREE 5,000,000,000+
Google LLC
Tools
Fast and smart typing with Emojis, GIFs, and more
Google Meet
Google Meet
Google Meet
★ 4.5 FREE 5,000,000,000+
Google LLC
Communication
High quality video calling for Android & iOS phones, tablets, Google Nest & web.
Google Calendar
Google Calendar
Google Calendar
★ 4.5 FREE 5,000,000,000+
Google LLC
Productivity
Always know what’s next with Google Calendar, part of Google Workspace.
Files by Google
Files by Google
Files by Google
★ 4.6 FREE 1,000,000,000+
Google LLC
Tools
Clean up your phone, find files, play media, and share files offline